X-Recipient: archive-cygwin AT delorie DOT com
DKIM-Filter: OpenDKIM Filter v2.11.0 sourceware.org 85706385840F
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cygwin.com;
	s=default; t=1671483582;
	bh=luz7a/BSlkMLQMPiAt+v0YrfDkqMfQ9o97jg2rxW4ww=;
	h=Date:Subject:To:References:In-Reply-To:List-Id:List-Unsubscribe:
	 List-Archive:List-Post:List-Help:List-Subscribe:From:Reply-To:
	 From;
	b=N9bm+07pRMu3rmYHAnPZnN05BBKloXuuImdm9Jbxtw6DqsBRuKMl3a+VcSpJut+QY
	 sD0P0uibGsA1yg8RVAf4JD5Jv8CmBPD4V8lVnEY4HCi1MhlBLfuhQd9RgOGAIZTJEA
	 NlX5URGD5DyGWoLwZmCLCO5l+QZz88czlVyJil+E=
X-Original-To: cygwin AT cygwin DOT com
Delivered-To: cygwin AT cygwin DOT com
DMARC-Filter: OpenDMARC Filter v1.4.1 sourceware.org C4AD13858D1E
X-SNCR-Rigid: 62E573CC15D1284D
X-Originating-IP: [81.153.98.246]
X-OWM-Source-IP: 81.153.98.246 (GB)
X-OWM-Env-Sender: jonturney AT btinternet DOT com
X-VadeSecure-score: verdict=clean score=0/300, class=clean
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedvhedrgeefgddutdehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffopdfqfgfvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefkffggfgfuvfhfhfgjtgfgsehtjeertddtfeejnecuhfhrohhmpeflohhnucfvuhhrnhgvhicuoehjohhnrdhtuhhrnhgvhiesughrohhnvggtohguvgdrohhrghdruhhkqeenucggtffrrghtthgvrhhnpeffkeeigfdujeehteduiefgjeeltdelgeelteekudetfedtffefhfeufefgueettdenucfkphepkedurdduheefrdelkedrvdegieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopegludelvddrudeikedruddruddtiegnpdhinhgvthepkedurdduheefrdelkedrvdegiedpmhgrihhlfhhrohhmpehjohhnrdhtuhhrnhgvhiesughrohhnvggtohguvgdrohhrghdruhhkpdhnsggprhgtphhtthhopedvpdhrtghpthhtoheptgihghifihhnsegthihgfihinhdrtghomhdprhgtphhtthhopehjjhhrvghishgvrhhtsegrlhhumhdrmhhithdrvgguuh
X-RazorGate-Vade-Verdict: clean 0
X-RazorGate-Vade-Classification: clean
Message-ID: <2a95408b-fd27-e739-c34c-758288d1eaea@dronecode.org.uk>
Date: Mon, 19 Dec 2022 20:59:02 +0000
MIME-Version: 1.0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101
 Thunderbird/102.6.0
Subject: Re: Xlib: sequence lost (0x10000 > 0x21c) in reply type 0x13!
To: Jim Reisert AD1C <jjreisert AT alum DOT mit DOT edu>,
        The Cygwin Mailing List <cygwin AT cygwin DOT com>
References: <CAK-n8j6DCq=8AmUc2cXr+yztPBOM1ySLgDbXtVqWOZah-B8Deg AT mail DOT gmail DOT com>
Content-Language: en-GB
In-Reply-To: <CAK-n8j6DCq=8AmUc2cXr+yztPBOM1ySLgDbXtVqWOZah-B8Deg@mail.gmail.com>
X-Spam-Status: No, score=-1192.2 required=5.0 tests=BAYES_00, FORGED_SPF_HELO,
 KAM_DMARC_STATUS, KAM_LAZY_DOMAIN_SECURITY, NICE_REPLY_A, RCVD_IN_DNSWL_NONE,
 SPF_HELO_PASS, SPF_NONE, TXREP autolearn=no autolearn_force=no version=3.4.6
X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on
 server2.sourceware.org
X-BeenThere: cygwin AT cygwin DOT com
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: General Cygwin discussions and problem reports <cygwin.cygwin.com>
List-Unsubscribe: <https://cygwin.com/mailman/options/cygwin>,
 <mailto:cygwin-request AT cygwin DOT com?subject=unsubscribe>
List-Archive: <https://cygwin.com/pipermail/cygwin/>
List-Post: <mailto:cygwin AT cygwin DOT com>
List-Help: <mailto:cygwin-request AT cygwin DOT com?subject=help>
List-Subscribe: <https://cygwin.com/mailman/listinfo/cygwin>,
 <mailto:cygwin-request AT cygwin DOT com?subject=subscribe>
From: Jon Turney via Cygwin <cygwin AT cygwin DOT com>
Reply-To: Jon Turney <jon DOT turney AT dronecode DOT org DOT uk>
Content-Transfer-Encoding: 7bit
Content-Type: text/plain; charset="us-ascii"; Format="flowed"
Errors-To: cygwin-bounces+archive-cygwin=delorie DOT com AT cygwin DOT com
Sender: "Cygwin" <cygwin-bounces+archive-cygwin=delorie DOT com AT cygwin DOT com>

On 19/12/2022 16:52, Jim Reisert AD1C via Cygwin wrote:
> I just updated Cygwin to "3.4.3-1.x86_64 2022-12-16 12:38 UTC x86_64
> Cygwin" and in addition the X package refresh.  I started emacs-X11 in
> an xterm and am now seeing this in the console:
> 
> Xlib: sequence lost (0x10000 > 0x16c) in reply type 0x13!
> Xlib: sequence lost (0x10000 > 0x172) in reply type 0x1c!
> Xlib: sequence lost (0x10000 > 0x17f) in reply type 0xf!
> Xlib: sequence lost (0x10000 > 0x185) in reply type 0x1c!
> Xlib: sequence lost (0x10000 > 0x1ba) in reply type 0xf!
> Xlib: sequence lost (0x10000 > 0x519) in reply type 0xf!
> 
> Did something go awry with the update?

This seems to be an upstream problem with libX11 1.8.3

I've withdrawn that version (so setup should automatically downgrade to 
the previous version, 1.8.1)


-- 
Problem reports:      https://cygwin.com/problems.html
FAQ:                  https://cygwin.com/faq/
Documentation:        https://cygwin.com/docs.html
Unsubscribe info:     https://cygwin.com/ml/#unsubscribe-simple