delorie.com/archives/browse.cgi | search |
X-Recipient: | archive-cygwin AT delorie DOT com |
X-Original-To: | cygwin AT cygwin DOT com |
Delivered-To: | cygwin AT cygwin DOT com |
DMARC-Filter: | OpenDMARC Filter v1.4.1 sourceware.org 22710385AC0F |
Authentication-Results: | sourceware.org; |
dmarc=none (p=none dis=none) header.from=acm.org | |
Authentication-Results: | sourceware.org; spf=fail smtp.mailfrom=acm.org |
DKIM-Signature: | v=1; a=rsa-sha256; c=relaxed/relaxed; |
d=comcastmailservice.net; s=20211018a; t=1648474641; | |
bh=m1qC3T+9Tz9b/7iydHsFiurvJjSYpExMVo6VLkYr9PU=; | |
h=Received:Received:Message-ID:Date:MIME-Version:To:From:Subject: | |
Content-Type; | |
b=m0ejN36ofXXftgS353CXzDDjod3qD/O18NK5fgCmvW/8QdSNuy81N9nRBauwzFJ9C | |
wNAqnqdt6zT9beFXEXnXxIugc6pbdG3sNa8aDeV6lsu6U4Aosy9oG5JAdIZBKr6g3j | |
Xcm1OrwcChxBdxzQV8OlzNF1JU87G8x+9CCzU63ocwM7r7khgHlyIqYdlwCkxyawwZ | |
mUiIGXAC8Ly4SgEjB4gywHBfMQpTg9thMIqVsLH78wMKXlDQZSMMNjlErhhSOezYtR | |
H+JF47UtdBG/BaaS/EqoWQxmlUPQO32hMLbGTqmqSfDbRc0HJUfvu9qWxQIg4V/kQZ | |
HR0xiqYQJ7mcg== | |
X-Xfinity-VAAS: | gggruggvucftvghtrhhoucdtuddrgedvvddrudehjedgieejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedtudenucenucfjughrpefkffggfgfvhffutgfgsehtjeertddtfeejnecuhfhrohhmpeevhhgrugcuffhouhhghhgvrhhthicuoegtrhgusegrtghmrdhorhhgqeenucggtffrrghtthgvrhhnpeehteevveelfeelieetgeefudfffeefveeuueehteekjeevveehveduuedtvdelgfenucfkphepuddvkedrvddrudegjedrudelieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopegluddvkedrvddrudegjedrudeliegnpdhinhgvthepuddvkedrvddrudegjedrudeliedpmhgrihhlfhhrohhmpegtrhgusegrtghmrdhorhhgpdhnsggprhgtphhtthhopedupdhrtghpthhtoheptgihghifihhnsegthihgfihinhdrtghomh |
X-Xfinity-VMeta: | sc=0.00;st=legit |
Message-ID: | <160224bb-9e4f-9b7a-b930-ec6440822413@acm.org> |
Date: | Mon, 28 Mar 2022 09:36:54 -0400 |
MIME-Version: | 1.0 |
User-Agent: | Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:91.0) Gecko/20100101 |
Thunderbird/91.7.0 | |
To: | cygwin AT cygwin DOT com |
From: | Chad Dougherty <crd AT acm DOT org> |
Subject: | Problems with python3 pip |
X-Spam-Status: | No, score=-0.4 required=5.0 tests=BAYES_00, DKIM_SIGNED, |
DKIM_VALID, SPF_HELO_NONE, SPF_SOFTFAIL, TXREP, | |
T_SCC_BODY_TEXT_LINE autolearn=no autolearn_force=no version=3.4.4 | |
X-Spam-Checker-Version: | SpamAssassin 3.4.4 (2020-01-24) on |
server2.sourceware.org | |
X-BeenThere: | cygwin AT cygwin DOT com |
X-Mailman-Version: | 2.1.29 |
List-Id: | General Cygwin discussions and problem reports <cygwin.cygwin.com> |
List-Archive: | <https://cygwin.com/pipermail/cygwin/> |
List-Post: | <mailto:cygwin AT cygwin DOT com> |
List-Help: | <mailto:cygwin-request AT cygwin DOT com?subject=help> |
List-Subscribe: | <https://cygwin.com/mailman/listinfo/cygwin>, |
<mailto:cygwin-request AT cygwin DOT com?subject=subscribe> | |
Sender: | "Cygwin" <cygwin-bounces+archive-cygwin=delorie DOT com AT cygwin DOT com> |
It seems to me like the ensurepip module has some problems. Shouldn't the following be working? $ cygcheck -c -d|grep python3 python3 3.9.10-1 python3-devel 3.9.10-1 python39 3.9.10-1 python39-devel 3.9.10-1 python39-pip 21.3.1-3 python39-setuptools 59.5.0-1 $ type python3.9 python3.9 is hashed (/usr/bin/python3.9) $ type pip3.9 pip3.9 is hashed (/usr/bin/pip3.9) $ pip3.9 --version pip 21.3.1 from /usr/lib/python3.9/site-packages/pip (python 3.9) $ pip3.9 list Package Version ---------- ------- pip 21.3.1 setuptools 59.5.0 WARNING: You are using pip version 21.3.1; however, version 22.0.4 is available. You should consider upgrading via the '/usr/bin/python3.9.exe -m pip install --upgrade pip' command. $ python3.9 -m ensurepip Traceback (most recent call last): File "/usr/lib/python3.9/runpy.py", line 188, in _run_module_as_main mod_name, mod_spec, code = _get_module_details(mod_name, _Error) File "/usr/lib/python3.9/runpy.py", line 147, in _get_module_details return _get_module_details(pkg_main_name, error) File "/usr/lib/python3.9/runpy.py", line 111, in _get_module_details __import__(pkg_name) File "/usr/lib/python3.9/ensurepip/__init__.py", line 30, in <module> _SETUPTOOLS_VERSION = _get_most_recent_wheel_version("setuptools") File "/usr/lib/python3.9/ensurepip/__init__.py", line 27, in _get_most_recent_wheel_version return str(max(_wheels[pkg], key=distutils.version.LooseVersion)) ValueError: max() arg is an empty sequence $ python3.9 -m ensurepip --user Traceback (most recent call last): File "/usr/lib/python3.9/runpy.py", line 188, in _run_module_as_main mod_name, mod_spec, code = _get_module_details(mod_name, _Error) File "/usr/lib/python3.9/runpy.py", line 147, in _get_module_details return _get_module_details(pkg_main_name, error) File "/usr/lib/python3.9/runpy.py", line 111, in _get_module_details __import__(pkg_name) File "/usr/lib/python3.9/ensurepip/__init__.py", line 30, in <module> _SETUPTOOLS_VERSION = _get_most_recent_wheel_version("setuptools") File "/usr/lib/python3.9/ensurepip/__init__.py", line 27, in _get_most_recent_wheel_version return str(max(_wheels[pkg], key=distutils.version.LooseVersion)) ValueError: max() arg is an empty sequence $ This causes the failure of "-m venv", which is what I ultimately want to do: $ python3.9 -m venv /home/crd/testvenv Error: Command '['/home/crd/testvenv/bin/python3.9.exe', '-Im', 'ensurepip', '--upgrade', '--default-pip']' returned non-zero exit status 1. I also tried python38 and had similar problems. Thanks... -- -Chad -- Problem reports: https://cygwin.com/problems.html FAQ: https://cygwin.com/faq/ Documentation: https://cygwin.com/docs.html Unsubscribe info: https://cygwin.com/ml/#unsubscribe-simple
webmaster | delorie software privacy |
Copyright © 2019 by DJ Delorie | Updated Jul 2019 |